PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00991.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 402aa    MW: 44406 Da    PI: 6.4436
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00991.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.7e-10193251563
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  e+
  Rsa1.0_00991.1_g00007.1 193 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTLLQRDTNGLSVEN 251
                              9********************************************99998877776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-15189253IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.657191254IPR004827Basic-leucine zipper domain
PfamPF001705.0E-9193245IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11193244No hitNo description
Gene3DG3DSA:1.20.5.1709.5E-11193247No hitNo description
CDDcd147033.89E-26194243No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MDKEKSPSGG LPPPSGRYSS FPHLTPPSGS TTTPDANRFC HDISRMPDNP PKNNLGHRRA  60
HSEILTLPDD LSFDSDLGVV GGDGPSFSDD TDEDLMSMYL DMDKFNSSAS SSCEPSELVW  120
RNELGGGGSA GSNLQSTPPS GSERPRIRHQ HSQSMDGSTS IKPEMLMSGN EGVDSKKAIS  180
AAKLSELALI DPKRAKRIWA NRQSAARSKE RKMRYIAELE RKVQTLQTEA TTLSAQLTLL  240
QRDTNGLSVE NHELKLRVQT VEQQVHLQDA LNDALKEEVQ HLKVLTGQGG SNGGASSVMN  300
YGSFGSNQQF YPNNQSMHTM QAAQQFQQLQ IHSQKQQQQQ FQYQQQQQQL YQLQLQLQQQ  360
RIQQQEQQSG VVAEPRRPMS SSSGGQKESV TSPDLESPST KD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533810.0AK353381.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009119093.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_013666639.10.0PREDICTED: probable transcription factor PosF21
SwissprotQ040881e-164POF21_ARATH; Probable transcription factor PosF21
TrEMBLM4DG480.0M4DG48_BRARP; Uncharacterized protein
STRINGBra015471.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-162bZIP family protein